Novus Biologicals
Manufacturer Code:NBP185293
Catalog # NBP185293
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP-dependent RNA helicase DDX1; ATP-dependent RNA helicase DDX1 DBP-RBDEAD box polypeptide 1 DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 DEAD box protein 1 DEAD box protein retinoblastoma DEAD box-1 DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1 EC 3.6.1 EC 3.6.1.10 EC 3.6.4.13 UKVH5d; DBP-RB; DEAD (Asp-Glu-Ala-Asp) box helicase 1; DEAD (Asp-Glu-Ala-Asp) box polypeptide 1; DEAD box polypeptide 1; DEAD box protein 1; DEAD box protein retinoblastoma; DEAD box-1; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1
Gene Aliases: DBP-RB; DDX1; UKVH5d
UniProt ID: (Human) Q92499
Entrez Gene ID: (Human) 1653
Molecular Function:
RNA binding protein
RNA helicase
helicase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.