Novus Biologicals
Manufacturer Code:NBP15542320UL
Catalog # NBP15542320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DCUN1D3(DCN1 defective in cullin neddylation 1 domain containing 3 (S. cerevisiae)) The peptide sequence was selected from the C terminal of DCUN1D3. Peptide sequence LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DCN1 defective in cullin neddylation 1 domain containing 3 (S. cerevisiae) DCN1-like protein 3 DCUN1 domain-containing protein 3 Defective in cullin neddylation protein 1-like protein 3 DKFZp686O0290 FLJ4172544M2.4 MGC48972; DCN1, defective in cullin neddylation 1, domain containing 3; DCN1-like protein 3; DCNL3; DCUN1 domain-containing protein 3; Defective in cullin neddylation protein 1-like protein 3; Squamous cell carcinoma-related oncogene 3
Gene Aliases: 44M2.4; DCUN1D3; SCCRO3
UniProt ID: (Human) Q8IWE4
Entrez Gene ID: (Human) 123879
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.