Novus Biologicals
Manufacturer Code:NBP185275
Catalog # NBP185275
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DCN1 defective in cullin neddylation 1 domain containing 1 (S. cerevisiae) DCN1-like protein 1 DCUN1L1DCUN1 domain-containing protein 1 Defective in cullin neddylation protein 1-like protein 1 RP42 homolog RP42Squamous cell carcinoma-related oncogene SCCROSCRO Tes3; DCN1, defective in cullin neddylation 1, domain containing 1; DCN1-like protein 1; DCNL1; DCUN1 domain-containing protein 1; Defective in cullin neddylation protein 1-like protein 1; RP42 homolog; squamous cell carcinoma related oncogene; Squamous cell carcinoma-related oncogene
Gene Aliases: DCN1; DCNL1; DCUN1D1; DCUN1L1; RP42; SCCRO; SCRO; Tes3
UniProt ID: (Human) Q8TEX7
Entrez Gene ID: (Human) 54165
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.