Novus Biologicals
Manufacturer Code:NBP157441
Catalog # NBP157441
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DCP2(DCP2 decapping enzyme homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of DCP2. Peptide sequence KQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DCP2 decapping enzyme homolog; DCP2 decapping enzyme homolog (S. cerevisiae) EC 3.- FLJ33245 hDpc mRNA-decapping enzyme 2 nudix (nucleoside diphosphate linked moiety X)-type motif 20 Nudix motif 20 NUDT20Nucleoside diphosphate-linked moiety X motif 20; hDpc; m7GpppN-mRNA hydrolase; mRNA-decapping enzyme 2; Nucleoside diphosphate-linked moiety X motif 20; nudix (nucleoside diphosphate linked moiety X)-type motif 20; Nudix motif 20
Gene Aliases: DCP2; NUDT20
UniProt ID: (Human) Q8IU60
Entrez Gene ID: (Human) 167227
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.