Novus Biologicals
Manufacturer Code:NBP256552
Catalog # NBP256552
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLKNREVRLQNETSYSRVLHGYAAQQLPSLLKEREFHLGTL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cancer/testis antigen 102; Centrosome-related protein TCC52; DDB1- and CUL4-associated factor 12; DDB1- and CUL4-associated factor 12 CT102 DDB1 and CUL4 associated factor 12 KIAA1892 TCC52 WDR40A; Testis cancer centrosome-related protein; WD repeat domain 40A; WD repeat-containing protein 40A
Gene Aliases: CT102; DCAF12; KIAA1892; TCC52; WDR40A
UniProt ID: (Human) Q5T6F0
Entrez Gene ID: (Human) 25853
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.