Novus Biologicals
Manufacturer Code:NBP159181
Catalog # NBP159181
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CLEC4M(C-type lectin domain family 4 member M) The peptide sequence was selected from the n terminal of CLEC4M. Peptide sequence MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C-type lectin domain family 4 member M; C-type lectin domain family 4, member M; CD209 antigen-like protein 1; CD209L1 CD209Ldendritic cell-specific ICAM-3-grabbing nonintegrin 2 CD299 CD299 antigenMGC129964 C-type lectin domain family 4 member M DC-SIGN2CD209 antigen-like protein 1 DC-SIGNRDC-SIGN-related protein DCSIGNRMGC47866 Dendritic cell-specific ICAM-3-grabbing non-integrin 2 HP10347 liver/lymph node-specific ICAM-3 grabbing non-integrin Liver/lymph node-specific ICAM-3-grabbing non-integrin L-SIGN LSIGNC-type lectin domain family 4 member M mannose binding C-type lectin DC-SIGNR; CD299; CD299 antigen; DC-SIGN-related protein; DC-SIGN2; DC-SIGNR; Dendritic cell-specific ICAM-3-grabbing non-integrin 2; L-SIGN; liver/lymph node-specific ICAM-3 grabbing non-integrin; Liver/lymph node-specific ICAM-3-grabbing non-integrin; mannose binding C-type lectin DC-SIGNR
Gene Aliases: CD209L; CD209L1; CD299; CLEC4M; DC-SIGN2; DC-SIGNR; DCSIGNR; HP10347; L-SIGN; LSIGN
UniProt ID: (Human) Q9H2X3
Entrez Gene ID: (Human) 10332
Molecular Function:
cell adhesion molecule
cytokine receptor
defense/immunity protein
immunoglobulin receptor superfamily
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.