Novus Biologicals
Manufacturer Code:NBP233616
Catalog # NBP233616
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNAT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CD208; CD208 antigen DC-LAMP DCLAMPDC-lysosome-associated membrane glycoprotein LAMP LAMP-3 lysosomal-associated membrane protein 3DC LAMP lysosome-associated membrane glycoprotein 3 Protein TSC403 TSC403CD208; DC LAMP; DC-lysosome-associated membrane glycoprotein; LAMP-3; lysosomal-associated membrane protein 3; Lysosome-associated membrane glycoprotein 3; Protein TSC403
Gene Aliases: CD208; DC LAMP; DC-LAMP; DCLAMP; LAMP; LAMP-3; LAMP3; TSC403
UniProt ID: (Human) Q9UQV4
Entrez Gene ID: (Human) 27074
Molecular Function: membrane traffic protein membrane trafficking regulatory protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.