Novus Biologicals
Manufacturer Code:NBP17921220UL
Catalog # NBP1792220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human DBX2The immunogen for this antibody is DBX2. Peptide sequence ALLNLPAAPGFGNLGKSFLIENLLRVGGAPTPRLQPPAPHDPATALATAG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: developing brain homeobox 2 developing brain homeobox protein 2 FLJ16139 homeobox protein DBX2; Developing brain homeobox protein 2; Homeobox protein DBX2
Gene Aliases: DBX2
UniProt ID: (Human) Q6ZNG2
Entrez Gene ID: (Human) 440097
Molecular Function:
DNA binding protein
helix-turn-helix transcription factor
homeobox transcription factor
nucleic acid binding
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.