Novus Biologicals
Manufacturer Code:NBP185963
Catalog # NBP185963
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:YVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 52 kDa mitochondrial autoantigen of primary biliary cirrhosis; BCATE2BCKAD E2 subunit BCKADE2 BCKAD-E2 branched chain acyltransferase E2 component Branched-chain alpha-keto acid dehydrogenase complex component E2 Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto aciddehydrogenase complex Dihydrolipoamide branched chain transacylase dihydrolipoamide branched chain transacylase (E2 component of branched chainketo acid dehydrogenase complex maple syrup urine disease) dihydrolipoamide branched chain transacylase E2 dihydrolipoyl transacylase Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase E2 E2 component of branched chain alpha-keto acid dehydrogenase complex E2B EC 2.3.1.168 lipoamide acyltransferase component of branched-chain alpha-keto aciddehydrogenase complex mitochondrial lipoamide acyltransferase component of mitochondrial branched-chain alpha-ketoacid dehydrogenase complex MGC9061 mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit(E2b); BCKAD E2 subunit; BCKAD-E2; BCOADC-E2; Branched chain 2-oxo-acid dehydrogenase complex component E2; branched chain acyltransferase, E2 component; Branched-chain alpha-keto acid dehydrogenase complex component E2; Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; Dihydrolipoamide branched chain transacylase; dihydrolipoyl transacylase; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase; E2 component of branched chain alpha-keto acid dehydrogenase complex; Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial; lipoamide acyltransferase component of mitochondrial branched-chain alpha-keto acid dehydrogenase complex; mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit (E2b)
Gene Aliases: BCATE2; BCKAD-E2; BCKADE2; BCOADC-E2; DBT; E2; E2B
UniProt ID: (Human) P11182
Entrez Gene ID: (Human) 1629
Molecular Function: acetyltransferase acyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.