Novus Biologicals
Manufacturer Code:NBP188049
Catalog # NBP188049
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cold shock domain protein A; cold shock domain protein A Cold shock domain-containing protein A cold-shock domain protein A CSDA1 dbpA DBPAcold-shock domain containing A1 DNA-binding protein A Single-strand DNA-binding protein NF-GMB ZO-1-associated nucleic acid-binding protein ZONAB; Cold shock domain-containing protein A; cold-shock domain containing A1; cold-shock domain protein A; DNA-binding protein A; Single-strand DNA-binding protein NF-GMB; Y box binding protein 3; Y-box-binding protein 3; ZO-1-associated nucleic acid-binding protein
Gene Aliases: CSDA; CSDA1; DBPA; YBX3; ZONAB
UniProt ID: (Human) P16989
Entrez Gene ID: (Human) 8531
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.