Novus Biologicals
Manufacturer Code:NBP157409
Catalog # NBP157409
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DAZ3(deleted in azoospermia 3) The peptide sequence was selected from the middle region of DAZ3. Peptide sequence PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: deleted in azoospermia 3 deleted in azoospermia protein 3 MGC126441 pDP1679; Deleted in azoospermia protein 3
Gene Aliases: DAZ3; pDP1679
UniProt ID: (Human) Q9NR90
Entrez Gene ID: (Human) 57054
Molecular Function:
RNA binding protein
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.