Novus Biologicals
Manufacturer Code:NBP233675
Catalog # NBP233675
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: D-amino acid oxidase activator; D-Amino Acid Oxidase Activator G72 G72 Transcript LG72 Protein G72 Schizophrenia- And Bipolar Disorder-Associated Protein G72 SG72; G72 transcript; Protein G72; schizophrenia- and bipolar disorder-associated protein G72
Gene Aliases: DAOA; G72; LG72; SG72
UniProt ID: (Human) P59103
Entrez Gene ID: (Human) 267012
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.