Novus Biologicals
Manufacturer Code:NBP15488120UL
Catalog # NBP1548820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DAK(dihydroxyacetone kinase 2 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of DAK. Peptide sequence MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP-dependent dihydroxyacetone kinase; ATP-dependent dihydroxyacetone kinase bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing) DHA kinase Dha kinase/FMN cyclase dihydroxyacetone kinase 2 homolog (S. cerevisiae) dihydroxyacetone kinase 2 homolog (yeast) DKFZp586B1621 FAD-AMP lyase cyclic FMN forming FAD-AMP lyase cyclizing glycerone kinase MGC5621 NET45; Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); DHA kinase; Dha kinase/FMN cyclase; dihydroxyacetone kinase 2 homolog; FAD-AMP lyase (cyclic FMN forming); FAD-AMP lyase (cyclizing); FAD-AMP lyase cyclic FMN forming; FAD-AMP lyase cyclizing; FMN cyclase; Glycerone kinase; testis tissue sperm-binding protein Li 84P; Triokinase; Triokinase/FMN cyclase; Triose kinase
Gene Aliases: DAK; NET45; TKFC
UniProt ID: (Human) Q3LXA3
Entrez Gene ID: (Human) 26007
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.