Novus Biologicals
Manufacturer Code:NBP153127
Catalog # NBP153127
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DAAM1(dishevelled associated activator of morphogenesis 1) The peptide sequence was selected from the middle region of DAAM1. Peptide sequence GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
For Research Use Only
Protein Aliases: Disheveled-associated activator of morphogenesis 1; disheveled-associated activator of morphogenesis 1 dishevelled associated activator of morphogenesis 1 dishevelled-associated activator of morphogenesis 1 KIAA0666FLJ41657
Gene Aliases: DAAM1; KIAA0666
UniProt ID: (Human) Q9Y4D1
Entrez Gene ID: (Human) 23002
Molecular Function:
actin family cytoskeletal protein
cytoskeletal protein
non-motor actin binding protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.