Novus Biologicals
Manufacturer Code:NBP233396
Catalog # NBP233396
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alcohol sulfotransferase; Alcohol sulfotransferase EC 2.8.2 EC 2.8.2.2 HSST2sulfotransferase family cytosolic 2B member 1 Hydroxysteroid sulfotransferase 2 ST2B1 Sulfotransferase 2B1 sulfotransferase family cytosolic 2B member 1; Hydroxysteroid sulfotransferase 2; ST2B1; Sulfotransferase 2B1; Sulfotransferase family 2B member 1; Sulfotransferase family cytosolic 2B member 1; sulfotransferase family, cytosolic, 2B, member 1
Gene Aliases: HSST2; SULT2B1
UniProt ID: (Human) O00204
Entrez Gene ID: (Human) 6820
Molecular Function: transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.