Novus Biologicals
Manufacturer Code:NBP232604
Catalog # NBP232604
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alcohol/hydroxysteroid sulfotransferase; alcohol/hydroxysteroid sulfotransferase Dehydroepiandrosterone sulfotransferase DHEAS DHEA-STbile salt sulfotransferase EC 2.8.2.14 HST hSTa Hydroxysteroid Sulfotransferase ST2 ST2A1 ST2A3 STDbile-salt sulfotranasferase 2A1 Sulfotransferase 2A1 sulfotransferase family cytosolic 2A dehydroepiandrosterone(DHEA)-preferring member 1; Bile salt sulfotransferase; bile-salt sulfotranasferase 2A1; Dehydroepiandrosterone sulfotransferase; DHEA-ST; HST; Hydroxysteroid Sulfotransferase; ST2; ST2A1; Sulfotransferase 2A1; sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1; SULT2A3
Gene Aliases: DHEA-ST; DHEAS; HST; hSTa; ST2; ST2A1; ST2A3; STD; SULT2A1
UniProt ID: (Human) Q06520
Entrez Gene ID: (Human) 6822
Molecular Function:
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.