Novus Biologicals
Manufacturer Code:NBP154829
Catalog # NBP154829
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SULT1B1(sulfotransferase family cytosolic 1B member 1) The peptide sequence was selected from the N terminal of SULT1B1. Peptide sequence MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.8.2 EC 2.8.2.- EC 2.8.2.1 EC 2.8.2.4 MGC13356 ST1B1 ST1B2sulfotransferase family cytosolic 1B member 1 Sulfotransferase 1B1 Sulfotransferase 1B2 sulfotransferase family cytosolic 1B member 1 SULT1B2 Thyroid hormone sulfotransferase; ST1B1; ST1B2; sulfotransferase 1B1; Sulfotransferase 1B2; Sulfotransferase family cytosolic 1B member 1; sulfotransferase family, cytosolic, 1B, member 1; Thyroid hormone sulfotransferase
Gene Aliases: ST1B1; ST1B2; SULT1B1; SULT1B2
UniProt ID: (Human) O43704
Entrez Gene ID: (Human) 27284
Molecular Function:
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.