Novus Biologicals
Manufacturer Code:NBP238337
Catalog # NBP238337
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Carnosine dipeptidase II; CN2cytosolic non-specific dipeptidase CNDP dipeptidase 2 CNDP dipeptidase 2 (metallopeptidase M20 family) CPGLcytosolic nonspecific dipeptidase FLJ10830 HsT2298 PEPAEC 3.4.13.18 Peptidase AGlutamate carboxypeptidase-like protein 1; CNDP dipeptidase 2; Cytosolic non-specific dipeptidase; cytosolic nonspecific dipeptidase; Epididymis secretory protein Li 13; Glutamate carboxypeptidase-like protein 1; Peptidase A
Gene Aliases: CN2; CNDP2; CPGL; HEL-S-13; HsT2298; PEPA
UniProt ID: (Human) Q96KP4
Entrez Gene ID: (Human) 55748
Molecular Function: deacetylase hydrolase metalloprotease protease
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.