Novus Biologicals
Manufacturer Code:NBP159573
Catalog # NBP159573
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CYBA(cytochrome b-245 alpha polypeptide) The peptide sequence was selected from the middle region of CYBA. Peptide sequence TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cytochrome b light chain; cytochrome b light chain Cytochrome b(558) alpha chain cytochrome b(558) alpha-subunit cytochrome b alpha polypeptide cytochrome b-245 light chain cytochrome b-245 alpha polypeptide Cytochrome b558 subunit alpha flavocytochrome b-558 alpha polypeptide Neutrophil cytochrome b 22 kDa polypeptide p22 phagocyte B-cytochrome p22phox p22-phox Superoxide-generating NADPH oxidase light chain subunit; Cytochrome b(558) alpha chain; cytochrome b(558) alpha-subunit; cytochrome b, alpha polypeptide; Cytochrome b-245 light chain; cytochrome b-245, alpha polypeptide; Cytochrome b558 subunit alpha; flavocytochrome b-558 alpha polypeptide; Neutrophil cytochrome b 22 kDa polypeptide; p22 phagocyte B-cytochrome; p22-phox; p22phox; Superoxide-generating NADPH oxidase light chain subunit
Gene Aliases: CYBA; p22-PHOX
UniProt ID: (Human) P13498
Entrez Gene ID: (Human) 1535
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.