Novus Biologicals
Manufacturer Code:NBP169667
Catalog # NBP169667
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CYP3A4(cytochrome P450 family 3 subfamily A polypeptide 4) The peptide sequence was selected from the middle region of CYP3A4 (NP_059488). Peptide sequence MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1,4-cineole 2-exo-monooxygenase; 1,8-cineole 2-exo-monooxygenase; albendazole monooxygenase; Albendazole monooxygenase (sulfoxide-forming); Albendazole monooxygenase Albendazole sulfoxidase CP33 CP34 CYP3A CYP3A3 CYPIIIA3 CYPIIIA4 Cytochrome P450 3A3 cytochrome P450 3A4 Cytochrome P450 HLp Cytochrome P450 NF-25 cytochrome P450 family 3 subfamily A polypeptide 4 cytochrome P450 subfamily IIIA (niphedipine oxidase) polypeptide 3 cytochrome P450 subfamily IIIA (niphedipine oxidase) polypeptide 4 Cytochrome P450-PCN1 EC 1.14.13.32 EC 1.14.13.67 EC 1.14.13.97 EC 1.14.14.1 glucocorticoid-inducible P450 HLP MGC126680 NF-25 Nifedipine oxidase P450C3 P450-III steroid inducible P450PCN1 Quinine 3-monooxygenase Taurochenodeoxycholate 6-alpha-hydroxylase; Albendazole sulfoxidase; Cholesterol 25-hydroxylase; CYPIIIA3; CYPIIIA4; Cytochrome P450 3A3; Cytochrome P450 3A4; Cytochrome P450 HLp; Cytochrome P450 NF-25; cytochrome P450, family 3, subfamily A, polypeptide 4; cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 3; cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4; Cytochrome P450-PCN1; glucocorticoid-inducible P450; Nifedipine oxidase; P450-III, steroid inducible; Quinine 3-monooxygenase; taurochenodeoxycholate 6-alpha-hydroxylase
Gene Aliases: CP33; CP34; CYP3A; CYP3A3; CYP3A4; CYPIIIA3; CYPIIIA4; HLP; NF-25; P450C3; P450PCN1
UniProt ID: (Human) Q16757
Entrez Gene ID: (Human) 1576
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.