Novus Biologicals
Manufacturer Code:NBP188055
Catalog # NBP188055
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CPC8 CYPIIC8 cytochrome P450 2C8 Cytochrome P450 form 1 Cytochrome P450 IIC2 Cytochrome P450 MP-12 Cytochrome P450 MP-20 cytochrome P450 family 2 subfamily C polypeptide 8 cytochrome P450 subfamily IIC (mephenytoin 4-hydroxylase) polypeptide 8 EC 1.14.14.1 flavoprotein-linked monooxygenase microsomal monooxygenase MP-12/MP-20 P450 form 1 S-mephenytoin 4-hydroxylase xenobiotic monooxygenase; CYPIIC8; Cytochrome P450 2C8; Cytochrome P450 form 1; Cytochrome P450 IIC2; Cytochrome P450 MP-12; Cytochrome P450 MP-20; cytochrome P450, family 2, subfamily C, polypeptide 8; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 8; flavoprotein-linked monooxygenase; microsomal monooxygenase; P450 form 1; S-mephenytoin 4-hydroxylase; xenobiotic monooxygenase
Gene Aliases: CPC8; CYP2C8; CYPIIC8; MP-12/MP-20
UniProt ID: (Human) P10632
Entrez Gene ID: (Human) 1558
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.