Novus Biologicals
Manufacturer Code:NBP162391
Catalog # NBP162391
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CYP1A1(cytochrome P450 family 1 subfamily A polypeptide 1) The peptide sequence was selected from the middle region of CYP1A1. Peptide sequence FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AHH AHRR aryl hydrocarbon hydroxylase CP11 CYP1 CYPIA1 cytochrome P1-450 dioxin-inducible cytochrome P450 1A1 Cytochrome P450 form 6 cytochrome P450 family 1 subfamily A polypeptide 1 Cytochrome P450-C Cytochrome P450-P1 EC 1.14.14.1 flavoprotein-linked monooxygenase P1-450 P450-C P450DX subfamily I (aromatic compound-inducible) polypeptide 1 xenobiotic monooxygenase; aryl hydrocarbon hydroxylase; CYPIA1; cytochrome P1-450, dioxin-inducible; Cytochrome P450 1A1; Cytochrome P450 form 6; cytochrome P450, family 1, subfamily A, polypeptide 1; cytochrome P450, subfamily I (aromatic compound-inducible), polypeptide 1; Cytochrome P450-C; Cytochrome P450-P1; flavoprotein-linked monooxygenase; Hydroperoxy icosatetraenoate dehydratase; xenobiotic monooxygenase
Gene Aliases: AHH; AHRR; CP11; CYP1; CYP1A1; CYPIA1; P1-450; P450-C; P450DX
UniProt ID: (Human) P04798
Entrez Gene ID: (Human) 1543
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.