Novus Biologicals
Manufacturer Code:NBP183317
Catalog # NBP183317
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: beta-lysase, kidney; cysteine conjugate beta lyase 1; cysteine conjugate-beta lyase cytoplasmic cysteine conjugate-beta lyase cytoplasmic (glutamine transaminase K Cysteine-S-conjugate beta-lyase EC 2.6.1.64 EC 2.6.1.7 EC 4.4.1.13 FLJ95217 Glutamine transaminase K glutamine-phenylpyruvate aminotransferase Glutamine--phenylpyruvate transaminase GTKMGC29624 KAT1 KATIbeta-lysase kidney kyneurenine aminotransferase kyneurenine aminotransferase) Kynurenine aminotransferase I kynurenine--oxoglutarate transaminase 1 Kynurenine--oxoglutarate transaminase I; cysteine conjugate-beta lyase, cytoplasmic; cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase); Cysteine-S-conjugate beta-lyase; Glutamine transaminase K; Glutamine--phenylpyruvate transaminase; glutamine-phenylpyruvate aminotransferase; GTK; KATI; kyneurenine aminotransferase; Kynurenine aminotransferase 1; Kynurenine aminotransferase I; Kynurenine--oxoglutarate transaminase 1; Kynurenine--oxoglutarate transaminase I
Gene Aliases: CCBL1; GTK; KAT1; KATI; KYAT1
UniProt ID: (Human) Q16773
Entrez Gene ID: (Human) 883
Molecular Function:
transaminase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.