Novus Biologicals
Manufacturer Code:NBP152849
Catalog # NBP152849
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunoprecipitation (IP) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CTH(cystathionase (cystathionine gamma-lyase)) The peptide sequence was selected from the N terminal of human CTH. Peptide sequence VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cystathionase (cystathionine gamma-lyase); cystathionase (cystathionine gamma-lyase) cystathionine gamma-lyase cysteine desulfhydrase EC 4.4.1 EC 4.4.1.1 gamma-cystathionase homoserine deaminase homoserine dehydratase MGC9471; Cystathionine gamma-lyase; cysteine desulfhydrase; Cysteine-protein sulfhydrase; Gamma-cystathionase; homoserine deaminase; homoserine dehydratase
Gene Aliases: CTH
UniProt ID: (Human) P32929
Entrez Gene ID: (Human) 1491
Molecular Function:
lyase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.