Novus Biologicals
Manufacturer Code:NBP154388
Catalog # NBP154388
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PPIA(peptidylprolyl isomerase A (cyclophilin A)) The peptide sequence was selected from the middle region of PPIA. Peptide sequence TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cyclophilin A; Cyclophilin A Cyclosporin A-binding protein CYPAMGC12404 CYPH EC 5.2.1.8 MGC117158 MGC23397 peptidyl-prolyl cis-trans isomerase A peptidylprolyl isomerase A (cyclophilin A) PPIase A Rotamase A T cell cyclophilin; Cyclosporin A-binding protein; epididymis secretory sperm binding protein Li 69p; Peptidyl-prolyl cis-trans isomerase A; Peptidyl-prolyl cis-trans isomerase A, N-terminally processed; peptidylprolyl isomerase A (cyclophilin A); PPIase A; Rotamase A; T cell cyclophilin
Gene Aliases: CYPA; CYPH; HEL-S-69p; PPIA
UniProt ID: (Human) P62937
Entrez Gene ID: (Human) 5478
Molecular Function: isomerase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.