Novus Biologicals
Manufacturer Code:NBP185363
Catalog # NBP185363
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 40 kDa peptidyl-prolyl cis-trans isomerase; 40 kDa peptidyl-prolyl cis-trans isomerase 40 kDa peptidyl-prolyl cis-trans isomerase D cyclophilin D Cyclophilin-40 Cyclophilin-related protein CYP40 CYP-40cyclophilin 40 CYPD EC 5.2.1.8 MGC33096 peptidyl-prolyl cis-trans isomerase D peptidylprolyl isomerase D peptidylprolyl isomerase D (cyclophilin D) PPIase D Rotamase D; 40 kDa peptidyl-prolyl cis-trans isomerase D; cyclophilin 40; cyclophilin D; Cyclophilin-40; Cyclophilin-related protein; CYP-40; Peptidyl-prolyl cis-trans isomerase D; PPIase D; Rotamase D; testicular tissue protein Li 147
Gene Aliases: CYP-40; CYP40; CYPD; PPID
UniProt ID: (Human) Q08752
Entrez Gene ID: (Human) 5481
Molecular Function:
isomerase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.