Novus Biologicals
Manufacturer Code:NBP158041
Catalog # NBP158041
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to BMPER(BMP binding endothelial regulator) The peptide sequence was selected from the C terminal of BMPER. Peptide sequence NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BMP binding endothelial regulator BMP-binding endothelial regulator precursor protein BMP-binding endothelial regulator protein Bone morphogenetic protein-binding endothelial cell precursor-derived regulator CRIM3 crossveinless 2 crossveinless-2 Cv2 CV-2 hCV2 KIAA1965 Protein crossveinless-2; BMP-binding endothelial regulator precursor protein; BMP-binding endothelial regulator protein; Bone morphogenetic protein-binding endothelial cell precursor-derived regulator; crossveinless 2; crossveinless-2; hCV2; Protein crossveinless-2
Gene Aliases: BMPER; CRIM3; CV-2; CV2; KIAA1965
UniProt ID: (Human) Q8N8U9
Entrez Gene ID: (Human) 168667
Molecular Function:
cell adhesion molecule
extracellular matrix glycoprotein
extracellular matrix protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.