Novus Biologicals
Manufacturer Code:NBP159204
Catalog # NBP159204
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GJA5 (gap junction protein alpha 5 40kDa) The peptide sequence was selected from the N terminal of GJA5. Peptide sequence STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha 5 40kD (connexin 40) connexin-40 Cx40 gap junction alpha-5 protein gap junction protein alpha 5 40kDa gap junction protein alpha 5 40kDa (connexin 40) MGC11185; connexin 40; Connexin-40; Cx40; Gap junction alpha-5 protein; gap junction protein alpha 5 40kDa
Gene Aliases: ATFB11; CX40; GJA5
UniProt ID: (Human) P36382
Entrez Gene ID: (Human) 2702
Molecular Function:
cell junction protein
gap junction
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.