Novus Biologicals
Manufacturer Code:NBP214122
Catalog # NBP214122
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNC TWNSSSEPQPTNLTLHYWYKNSDNDK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CD132; CD132 antigen; CD132 CD132 antigen CIDX combined immunodeficiency X-linked common cytokine receptor gamma chain common gamma-chain cytokine receptor common subunit gamma gamma(c) IL-2 receptor subunit gamma IL-2R subunit gamma IL-2RG IMD4 interleukin 2 receptor gamma Interleukin-2 receptor subunit gamma p64 SCIDX SCIDX1 severe combined immunodeficiency; common cytokine receptor gamma chain; Cytokine receptor common subunit gamma; gammaC; IL-2 receptor subunit gamma; IL-2R subunit gamma; interleukin 2 receptor, gamma; Interleukin-2 receptor subunit gamma; p64
Gene Aliases: CD132; CIDX; IL-2RG; IL2RG; IMD4; P64; SCIDX; SCIDX1
UniProt ID: (Human) P31785
Entrez Gene ID: (Human) 3561
Molecular Function:
cytokine
defense/immunity protein
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.