Novus Biologicals
Manufacturer Code:NBP16894220UL
Catalog # NBP16894220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to COL1A1 (collagen type I alpha 1) The peptide sequence was selected from the C terminal of COL1A1. Peptide sequence YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alpha-1 type I collagen; Alpha-1 type I collagen Collagen 1 Collagen 1 alpha 1 collagen alpha 1 chain type I collagen alpha-1(I) chain collagen of skin tendon and bone alpha-1 chain collagen type I alpha 1 Collagen1 Collagen-1 OI4 pro-alpha-1 collagen type 1; alpha1(I) procollagen; collagen alpha 1 chain type I; Collagen alpha-1(I) chain; collagen alpha-1(I) chain preproprotein; collagen of skin, tendon and bone, alpha-1 chain; collagen, type I, alpha 1; pro-alpha-1 collagen type 1; type I proalpha 1; type I procollagen alpha 1 chain
Gene Aliases: COL1A1; EDSC; OI1; OI2; OI3; OI4
UniProt ID: (Human) P02452
Entrez Gene ID: (Human) 1277
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.