Novus Biologicals
Manufacturer Code:NBP16889620UL
Catalog # NBP16889620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to F7 (coagulation factor VII (serum prothrombin conversion accelerator)) The peptide sequence was selected form the middle region of F7. Peptide sequence RCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Coagulation factor VII; coagulation factor VII (serum prothrombin conversion accelerator); coagulation factor VII coagulation factor VII (serum prothrombin conversion accelerator) EC 3.4.21 EC 3.4.21.21 Eptacog alfa FVII coagulation protein Proconvertin Serum prothrombin conversion accelerator SPCA; Eptacog alfa; Factor VII heavy chain; Factor VII light chain; FVII coagulation protein; Proconvertin; Serum prothrombin conversion accelerator; SPCA
Gene Aliases: F7; SPCA
UniProt ID: (Human) P08709
Entrez Gene ID: (Human) 2155
Molecular Function:
annexin
calcium-binding protein
calmodulin
enzyme modulator
hydrolase
intracellular calcium-sensing protein
peptide hormone
protease
protease inhibitor
receptor
serine protease
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.