Novus Biologicals
Manufacturer Code:NBP15925020UL
Catalog # NBP15925020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CLDN18(claudin 18) The peptide sequence was selected from the middle region of CLDN18. Peptide sequence YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: claudin 18 claudin-18 DKFZp564B2062 SFTA5 SFTPJ surfactant associated 5 surfactant associated protein J surfactant pulmonary associated protein J; Claudin-18; surfactant associated 5; surfactant associated protein J; surfactant, pulmonary associated protein J
Gene Aliases: CLDN18; SFTA5; SFTPJ; UNQ778/PRO1572
UniProt ID: (Human) P56856
Entrez Gene ID: (Human) 51208
Molecular Function: cell junction protein tight junction
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.