Novus Biologicals
Manufacturer Code:NBP159105
Catalog # NBP159105
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CLDN16 (claudin 16) The peptide sequence was selected from the C terminal of CLDN16. Peptide sequence FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: claudin 16 claudin-16 HOMG3paracellin-1 Paracellin-1 PCLN-1 PCLN1hypomagnesemia 3 with hypercalciuria and nephrocalcinosis; Claudin-16; hypomagnesemia 3, with hypercalciuria and nephrocalcinosis; Paracellin-1; PCLN-1
Gene Aliases: CLDN16; HOMG3; PCLN1
UniProt ID: (Human) Q9Y5I7
Entrez Gene ID: (Human) 10686
Molecular Function: cell junction protein tight junction
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.