Novus Biologicals
Manufacturer Code:NBP15666820UL
Catalog # NBP15666820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CHKA(choline kinase alpha) The peptide sequence was selected from the middle region of CHKA (NP_001268). Peptide sequence LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CHETK-alpha; CHETK-alpha CHK choline kinase choline kinase alpha CK CKIethanolamine kinase EC 2.7.1.32 EC 2.7.1.82 EK Ethanolamine kinase; Choline kinase alpha; CK; EK; Ethanolamine kinase
Gene Aliases: CHK; CHKA; CK; CKI; EK
UniProt ID: (Human) P35790
Entrez Gene ID: (Human) 1119
Molecular Function:
kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.