Novus Biologicals
Manufacturer Code:NBP159219
Catalog # NBP159219
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CHGN The peptide sequence was selected from the C terminal of CHGN. Peptide sequence DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: beta4GalNAcT Beta4GalNAcT-1 CHGN chondroitin beta14 N-acetylgalactosaminyltransferase Chondroitin beta-14-N-acetylgalactosaminyltransferase 1 chondroitin sulfate N-acetylgalactosaminyltransferase 1 CSGalNAcT-1 EC 2.4.1.174 FLJ11264 FLJ13760 GALNACT1; Beta4GalNAcT-1; Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1; chondroitin beta1,4 N-acetylgalactosaminyltransferase; Chondroitin sulfate N-acetylgalactosaminyltransferase 1; CsGalNAcT-1; glucuronylgalactosylproteoglycan 4-beta-N- acetylgalactosaminyltransferase
Gene Aliases: beta4GalNAcT; CHGN; CSGalNAcT-1; CSGALNACT1; GALNACT1; UNQ656/PRO1287
UniProt ID: (Human) Q8TDX6
Entrez Gene ID: (Human) 55790
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.