Novus Biologicals
Manufacturer Code:NBP238750
Catalog # NBP238750
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDC20 cell division cycle 20 homolog; CDC20 cell division cycle 20 homolog CDC20 cell division cycle 20 homolog (S. cerevisiae) cell division cycle 20 homolog (S. cerevisiae) cell division cycle protein 20 homolog MGC102824 p55CDCS. cerevisiae homolog); cell division cycle 20 homolog; Cell division cycle protein 20 homolog; p55CDC
Gene Aliases: bA276H19.3; CDC20; CDC20A; p55CDC
UniProt ID: (Human) Q12834
Entrez Gene ID: (Human) 991
Molecular Function: enzyme modulator
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.