Novus Biologicals
Manufacturer Code:NBP152975
Catalog # NBP152975
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CSNK1D(casein kinase 1 delta) The peptide sequence was selected from the middle region of CSNK1D. Peptide sequence NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: casein kinase 1 delta casein kinase I isoform delta CKId CKI-delta EC 2.7.11 EC 2.7.11.1 HCKID; casein kinase 1, delta; Casein kinase I isoform delta; CKI-delta; CKId; Tau-protein kinase CSNK1D
Gene Aliases: ASPS; CKIdelta; CSNK1D; FASPS2; HCKID
UniProt ID: (Human) P48730
Entrez Gene ID: (Human) 1453
Molecular Function:
kinase
non-receptor serine/threonine protein kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.