Novus Biologicals
Manufacturer Code:NBP231611
Catalog # NBP231611
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C6ST-1; C6ST-1 C6ST1HSD C6STEC 2.8.2.17 carbohydrate (chondroitin 6) sulfotransferase 3 carbohydrate sulfotransferase 3 Chondroitin 6-O-sulfotransferase 1 Chondroitin 6-sulfotransferase EC 2.8.2 Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0 GST-0; carbohydrate (chondroitin 6) sulfotransferase 3; Carbohydrate sulfotransferase 3; chondroitin 6 sulfotransferase 1; Chondroitin 6-O-sulfotransferase 1; Chondroitin 6-sulfotransferase; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0; GST-0
Gene Aliases: C6ST; C6ST1; CHST3; HSD
UniProt ID: (Human) Q7LGC8
Entrez Gene ID: (Human) 9469
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.