Novus Biologicals
Manufacturer Code:NBP159944
Catalog # NBP159944
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CHST2(carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2) The peptide sequence was selected from the middle region of CHST2. Peptide sequence NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C6ST carbohydrate (chondroitin 6/keratan) sulfotransferase 2 carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 carbohydrate sulfotransferase 2 EC 2.8.2.- Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2 glcNAc6ST-1 GN6ST Gn6ST-1 GST2 GST-2 N-acetylglucosamine 6-O-sulfotransferase 1; carbohydrate (chondroitin 6/keratan) sulfotransferase 2; carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2; Carbohydrate sulfotransferase 2; epididymis secretory protein Li 75; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2; GlcNAc6ST-1; GST-2; N-acetylglucosamine 6-O-sulfotransferase 1
Gene Aliases: C6ST; CHST2; glcNAc6ST-1; GN6ST; Gn6ST-1; GST-2; GST2; HEL-S-75
UniProt ID: (Human) Q9Y4C5
Entrez Gene ID: (Human) 9435
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.