Novus Biologicals
Manufacturer Code:NBP187304
Catalog # NBP187304
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: calsequestrin 2 (cardiac muscle); calsequestrin 2 (cardiac muscle) calsequestrin 2 fast-twitch cardiac muscle Calsequestrin cardiac muscle isoform calsequestrin-2 FLJ26321 FLJ93514 PDIB2; calsequestrin 2, fast-twitch, cardiac muscle; Calsequestrin, cardiac muscle isoform; Calsequestrin-2
Gene Aliases: CASQ2; PDIB2
UniProt ID: (Human) O14958
Entrez Gene ID: (Human) 845
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.