Novus Biologicals
Manufacturer Code:NBP158875
Catalog # NBP158875
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CANT1(calcium activated nucleotidase 1) The peptide sequence was selected from the middle region of CANT1. Peptide sequence SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Apyrase homolog; Apyrase homolog calcium activated nucleotidase 1 DBQD EC 3.6.1.6 Putative MAPK-activating protein PM09 Putative NF-kappa-B-activating protein 107 SCAN1 SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification soluble Ca-activated nucleotidase isozyme 1 soluble calcium-activated nucleotidase 1 soluble calcium-activated nucleotidase SCAN-1; Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase; micromelic dwarfism with vertebral and metaphyseal abnormalities and advanced carpotarsal ossification; Putative MAPK-activating protein PM09; Putative NF-kappa-B-activating protein 107; SCAN-1; soluble Ca-activated nucleotidase, isozyme 1; Soluble calcium-activated nucleotidase 1; soluble calcium-activated nucleotidase SCAN-1
Gene Aliases: CANT1; DBQD; DBQD1; SCAN-1; SCAN1; SHAPY
UniProt ID: (Human) Q8WVQ1
Entrez Gene ID: (Human) 124583
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.