Novus Biologicals
Manufacturer Code:NBP15681620UL
Catalog # NBP15681620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PPP3R1(protein phosphatase 3 (formerly 2B) regulatory subunit B alpha isoform) The peptide sequence was selected from the N terminal of PPP3R1. Peptide sequence MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: calcineurin B, type I (19kDa); Calcineurin subunit B type 1; calcineurin subunit B type 1 CNA2 CNB1 Protein phosphatase 2B regulatory subunit 1 protein phosphatase 2B regulatory subunit B alpha protein phosphatase 3 (formerly 2B) regulatory subunit B (19kD) alpha isoform(calcineurin B type I) protein phosphatase 3 (formerly 2B) regulatory subunit B 19kDa alpha isoform(calcineurin B type I) protein phosphatase 3 (formerly 2B) regulatory subunit B alpha isoform Protein phosphatase 3 regulatory subunit B alpha isoform 1 protein phosphatase 3 regulatory subunit B alpha type I (19kDa); Protein phosphatase 2B regulatory subunit 1; protein phosphatase 2B regulatory subunit B alpha; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I); protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I); protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform; Protein phosphatase 3 regulatory subunit B alpha isoform 1; protein phosphatase 3, regulatory subunit B, alpha
Gene Aliases: CALNB1; CNA2; CNB; CNB1; PPP3R1
UniProt ID: (Human) P63098
Entrez Gene ID: (Human) 5534
Molecular Function:
calcium-binding protein
calmodulin
hydrolase
intracellular calcium-sensing protein
phosphatase
protein phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.