Novus Biologicals
Manufacturer Code:NBP238798
Catalog # NBP238798
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CAB27 CALB calbindin calbindin 1 (28kD) calbindin 1 28kDa Calbindin D28 D-28K RTVL-H protein Vitamin D-dependent calcium-binding protein avian-type; Calbindin; calbindin 1, (28kD); calbindin 1, 28kDa; Calbindin D28; D-28K; RTVL-H protein; Vitamin D-dependent calcium-binding protein, avian-type
Gene Aliases: CAB27; CALB; CALB1; D-28K
UniProt ID: (Human) P05937
Entrez Gene ID: (Human) 793
Molecular Function:
calcium-binding protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.