Novus Biologicals
Manufacturer Code:NBP159271
Catalog # NBP159271
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CDH23(cadherin-like 23) The peptide sequence was selected from the middle region of CDH23. Peptide sequence DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cadherin related 23 cadherin-23 cadherin-like 23 cadherin-related 23 cadherin-related family member 23 CDHR23 DKFZp434P2350 FLJ00233 FLJ36499 KIAA1774 KIAA1812 MGC102761 Otocadherin USH1D; Cadherin-23; cadherin-like 23; cadherin-related family member 23; Otocadherin
Gene Aliases: CDH23; CDHR23; KIAA1774; KIAA1812; UNQ1894/PRO4340; USH1D
UniProt ID: (Human) Q9H251
Entrez Gene ID: (Human) 64072
Molecular Function:
cadherin
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.