Novus Biologicals
Manufacturer Code:NBP188237
Catalog # NBP188237
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GTKVGNVTAKDPEGLDISYSLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDVNDNPPRLAKDYT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cadherin 17, LI cadherin (liver-intestine); cadherin cadherin 17 LI cadherin (liver-intestine) cadherin-16 cadherin-17 CDH16 FLJ26931 HPT1 HPT-1 HPT-1 cadherin human intestinal peptide-associated transporter HPT-1 human peptide transporter 1 Intestinal peptide-associated transporter HPT-1 LI cadherin LI-cadherin Liver-intestine cadherin MGC138218 MGC142024; cadherin-16; Cadherin-17; HPT-1 cadherin; human intestinal peptide-associated transporter HPT-1; human peptide transporter 1; Intestinal peptide-associated transporter HPT-1; LI cadherin; LI-cadherin; Liver-intestine cadherin
Gene Aliases: CDH16; CDH17; HPT-1; HPT1
UniProt ID: (Human) Q12864
Entrez Gene ID: (Human) 1015
Molecular Function:
cadherin
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.