Novus Biologicals
Manufacturer Code:NBP257797
Catalog # NBP257797
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma; calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma calcium/calmodulin-dependent protein kinase II gamma calcium/calmodulin-dependent protein kinase type II subunit gamma CaM kinase II subunit gamma CAMK CAMKGFLJ16043 CAMK-II CaMK-II subunit gamma EC 2.7.11 EC 2.7.11.17 MGC26678; calcium/calmodulin-dependent protein kinase II gamma; Calcium/calmodulin-dependent protein kinase type II subunit gamma; CaM kinase II subunit gamma; caMK-II subunit gamma
Gene Aliases: CAMK; CAMK-II; CAMK2G; CAMKG
UniProt ID: (Human) Q13555
Entrez Gene ID: (Human) 818
Molecular Function:
non-receptor serine/threonine protein kinase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.