Novus Biologicals
Manufacturer Code:NBP179790
Catalog # NBP179790
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human CYP51A1The immunogen for this antibody is CYP51A1. Peptide sequence TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CP51 CYP51Cytochrome P450LI CYPL1 CYPLI Cytochrome P450 51A1 cytochrome P450 family 51 subfamily A polypeptide 1 Cytochrome P450-14DM EC 1.14.13.70 lanosterol 14-alpha demethylase lanosterol 14-alpha-demethylase LDMCytochrome P45014DM P450-14DM P450L151 (lanosterol 14-alpha-demethylase) Sterol 14-alpha demethylase; CYPLI; Cytochrome P450 51A1; cytochrome P450, 51 (lanosterol 14-alpha-demethylase); cytochrome P450, family 51, subfamily A, polypeptide 1; Cytochrome P450-14DM; Cytochrome P45014DM; Cytochrome P450LI; Lanosterol 14-alpha demethylase; lanosterol 14-alpha-demethylase; LDM; Sterol 14-alpha demethylase
Gene Aliases: CP51; CYP51; CYP51A1; CYPL1; LDM; P450-14DM; P450L1
UniProt ID: (Human) Q16850
Entrez Gene ID: (Human) 1595
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.