Novus Biologicals
Manufacturer Code:NBP160084
Catalog # NBP160084
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CYP4V2(cytochrome P450 family 4 subfamily V polypeptide 2) The peptide sequence was selected from the middle region of CYP4V2. Peptide sequence RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BCD CYP4AH1 cytochrome P450 4V2 cytochrome P450 family 4 subfamily V polypeptide 2 EC 1.14 EC 1.14.14.1 FLJ18432 MGC43534; Cytochrome P450 4V2; cytochrome P450, family 4, subfamily V, polypeptide 2; Docosahexaenoic acid omega-hydroxylase CYP4V2; Long-chain fatty acid omega-monooxygenase
Gene Aliases: BCD; CYP4AH1; CYP4V2
UniProt ID: (Human) Q6ZWL3
Entrez Gene ID: (Human) 285440
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.