Novus Biologicals
Manufacturer Code:NBP169678
Catalog # NBP169678
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CYP4F3(cytochrome P450 family 4 subfamily F polypeptide 3) The peptide sequence was selected from the N terminal of CYP4F3. Peptide sequence LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 20-HETE synthase; 20-hydroxyeicosatetraenoic acid synthase; CYP4F CYPIVF3 cytochrome P-450 Cytochrome P450 4F3 cytochrome P450 family 4 subfamily F polypeptide 3 cytochrome P450 subfamily IVF polypeptide 3 (leukotriene B4 omegahydroxylase) Cytochrome P450-LTB-omega EC 1.14.13.30 leukotriene B4 omega hydroxylase Leukotriene-B(4) 20-monooxygenase 2 leukotriene-B(4) omega-hydroxylase 2 leukotriene-B4 20-monooxygenase LTB4HCPF3; CYPIVF3; cytochrome P-450; Cytochrome P450 4F3; cytochrome P450, family 4, subfamily F, polypeptide 3; cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omega hydroxylase); Cytochrome P450-LTB-omega; Docosahexaenoic acid omega-hydroxylase CYP4F3; leukotriene B4 omega hydroxylase; Leukotriene-B(4) 20-monooxygenase 2; Leukotriene-B(4) omega-hydroxylase 2; leukotriene-B4 20-monooxygenase
Gene Aliases: CPF3; CYP4F; CYP4F3; LTB4H
UniProt ID: (Human) Q08477
Entrez Gene ID: (Human) 4051
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.