Novus Biologicals
Manufacturer Code:NBP186461
Catalog # NBP186461
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 20-HETE synthase; 20-hydroxyeicosatetraenoic acid synthase; Arachidonic acid omega-hydroxylase; CPF2 CYPIVF2 Cytochrome P450 4F2 cytochrome P450 family 4 subfamily F polypeptide 2 cytochrome P450 subfamily IVF polypeptide 2 Cytochrome P450-LTB-omega EC 1.14.13.30 leukotriene B4 omega-hydroxylase Leukotriene-B(4) 20-monooxygenase 1 leukotriene-B(4) omega-hydroxylase 1 leukotriene-B4 20-monooxygenase; CYPIVF2; Cytochrome P450 4F2; cytochrome P450, family 4, subfamily F, polypeptide 2; cytochrome P450, subfamily IVF, polypeptide 2; Cytochrome P450-LTB-omega; Docosahexaenoic acid omega-hydroxylase; Leukotriene-B(4) 20-monooxygenase 1; Leukotriene-B(4) omega-hydroxylase 1; Phylloquinone omega-hydroxylase CYP4F2
Gene Aliases: CPF2; CYP4F2
UniProt ID: (Human) P78329
Entrez Gene ID: (Human) 8529
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.